Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4326517..4327315 Replicon chromosome
Accession NZ_CP101210
Organism Escherichia coli strain EC21Z-147

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag NML26_RS21165 Protein ID WP_000854919.1
Coordinates 4326517..4326894 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag NML26_RS21170 Protein ID WP_001285608.1
Coordinates 4326941..4327315 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML26_RS21140 (4322017) 4322017..4322196 + 180 Protein_4141 peptidase -
NML26_RS21145 (4322595) 4322595..4324631 - 2037 WP_000417002.1 hypothetical protein -
NML26_RS21150 (4325587) 4325587..4325730 - 144 Protein_4143 hypothetical protein -
NML26_RS21155 (4325815) 4325815..4326012 - 198 WP_001327226.1 DUF957 domain-containing protein -
NML26_RS21160 (4326032) 4326032..4326520 - 489 WP_000777664.1 DUF5983 family protein -
NML26_RS21165 (4326517) 4326517..4326894 - 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
NML26_RS21170 (4326941) 4326941..4327315 - 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NML26_RS21175 (4327395) 4327395..4327616 - 222 WP_112021664.1 DUF987 domain-containing protein -
NML26_RS21180 (4327703) 4327703..4328179 - 477 WP_001560293.1 RadC family protein -
NML26_RS21185 (4328194) 4328194..4328673 - 480 WP_000706980.1 antirestriction protein -
NML26_RS21190 (4328773) 4328773..4328913 + 141 WP_000997937.1 hypothetical protein -
NML26_RS21195 (4328939) 4328939..4329757 - 819 WP_001175165.1 DUF932 domain-containing protein -
NML26_RS21200 (4329847) 4329847..4330080 - 234 WP_001278287.1 DUF905 family protein -
NML26_RS21205 (4330086) 4330086..4330763 - 678 WP_001097301.1 hypothetical protein -
NML26_RS21210 (4330911) 4330911..4331591 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / papC / papD 4314294..4353755 39461


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T251526 WP_000854919.1 NZ_CP101210:c4326894-4326517 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT251526 WP_001285608.1 NZ_CP101210:c4327315-4326941 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References