Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3978558..3979356 | Replicon | chromosome |
| Accession | NZ_CP101210 | ||
| Organism | Escherichia coli strain EC21Z-147 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NML26_RS19505 | Protein ID | WP_000854737.1 |
| Coordinates | 3978979..3979356 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
| Locus tag | NML26_RS19500 | Protein ID | WP_001285481.1 |
| Coordinates | 3978558..3978932 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML26_RS19460 (3974533) | 3974533..3974985 | + | 453 | WP_000682723.1 | hypothetical protein | - |
| NML26_RS19465 (3975103) | 3975103..3975336 | + | 234 | WP_001213776.1 | DUF905 family protein | - |
| NML26_RS19470 (3975436) | 3975436..3976257 | + | 822 | WP_001234359.1 | DUF932 domain-containing protein | - |
| NML26_RS19475 (3976257) | 3976257..3976502 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| NML26_RS19480 (3976596) | 3976596..3977069 | + | 474 | WP_001313575.1 | antirestriction protein | - |
| NML26_RS19485 (3977085) | 3977085..3977561 | + | 477 | WP_001313574.1 | RadC family protein | - |
| NML26_RS19490 (3977624) | 3977624..3977845 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| NML26_RS19495 (3977864) | 3977864..3978508 | + | 645 | WP_000086759.1 | hypothetical protein | - |
| NML26_RS19500 (3978558) | 3978558..3978932 | + | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NML26_RS19505 (3978979) | 3978979..3979356 | + | 378 | WP_000854737.1 | TA system toxin CbtA family protein | Toxin |
| NML26_RS19510 (3979353) | 3979353..3979845 | + | 493 | Protein_3825 | DUF5983 family protein | - |
| NML26_RS19515 (3979924) | 3979924..3980912 | - | 989 | Protein_3826 | IS630 family transposase | - |
| NML26_RS19520 (3981060) | 3981060..3982653 | - | 1594 | Protein_3827 | IS66 family transposase | - |
| NML26_RS19525 (3982684) | 3982684..3983034 | - | 351 | WP_000624707.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NML26_RS19530 (3983031) | 3983031..3983322 | - | 292 | Protein_3829 | transposase | - |
| NML26_RS19535 (3983364) | 3983364..3983558 | + | 195 | WP_001313570.1 | DUF957 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14240.26 Da Isoelectric Point: 7.8051
>T251525 WP_000854737.1 NZ_CP101210:3978979-3979356 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT251525 WP_001285481.1 NZ_CP101210:3978558-3978932 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|