Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1017079..1017733 | Replicon | chromosome |
| Accession | NZ_CP101210 | ||
| Organism | Escherichia coli strain EC21Z-147 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NML26_RS05010 | Protein ID | WP_000244781.1 |
| Coordinates | 1017326..1017733 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NML26_RS05005 | Protein ID | WP_000354046.1 |
| Coordinates | 1017079..1017345 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML26_RS04985 (1013157) | 1013157..1014590 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
| NML26_RS04990 (1014635) | 1014635..1014946 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
| NML26_RS04995 (1015110) | 1015110..1015769 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| NML26_RS05000 (1015846) | 1015846..1016826 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| NML26_RS05005 (1017079) | 1017079..1017345 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NML26_RS05010 (1017326) | 1017326..1017733 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NML26_RS05015 (1017773) | 1017773..1018294 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NML26_RS05020 (1018406) | 1018406..1019302 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NML26_RS05025 (1019327) | 1019327..1020037 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NML26_RS05030 (1020043) | 1020043..1021776 | + | 1734 | WP_000813191.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T251511 WP_000244781.1 NZ_CP101210:1017326-1017733 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|