Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 81411..81675 | Replicon | plasmid pEC21Z151-128K-NDM5 |
| Accession | NZ_CP101198 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | NML27_RS24820 | Protein ID | WP_001303307.1 |
| Coordinates | 81523..81675 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 81411..81473 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS24805 (76650) | 76650..78941 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| NML27_RS24810 (78934) | 78934..80004 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| NML27_RS24815 (80023) | 80023..81231 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (81411) | 81411..81473 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (81411) | 81411..81473 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (81411) | 81411..81473 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (81411) | 81411..81473 | - | 63 | NuclAT_0 | - | Antitoxin |
| NML27_RS24820 (81523) | 81523..81675 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| NML27_RS24825 (81747) | 81747..81998 | - | 252 | WP_001291968.1 | hypothetical protein | - |
| - (82385) | 82385..82436 | - | 52 | NuclAT_1 | - | - |
| - (82385) | 82385..82436 | - | 52 | NuclAT_1 | - | - |
| - (82385) | 82385..82436 | - | 52 | NuclAT_1 | - | - |
| - (82385) | 82385..82436 | - | 52 | NuclAT_1 | - | - |
| NML27_RS24830 (82922) | 82922..83098 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| NML27_RS24835 (83307) | 83307..83516 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| NML27_RS24840 (83614) | 83614..84228 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NML27_RS24845 (84304) | 84304..86472 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / mph(A) / aac(3)-IId / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B | - | 1..127790 | 127790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T251493 WP_001303307.1 NZ_CP101198:81523-81675 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT251493 NZ_CP101198:c81473-81411 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
