Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 4068495..4069057 | Replicon | chromosome |
Accession | NZ_CP101180 | ||
Organism | Paenarthrobacter ureafaciens strain SD-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NL395_RS19175 | Protein ID | WP_021472908.1 |
Coordinates | 4068767..4069057 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7M2BYL4 |
Locus tag | NL395_RS19170 | Protein ID | WP_021472907.1 |
Coordinates | 4068495..4068770 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL395_RS19150 (NL395_19100) | 4064718..4065755 | - | 1038 | WP_031216691.1 | zinc-dependent alcohol dehydrogenase family protein | - |
NL395_RS19155 (NL395_19105) | 4065885..4066697 | - | 813 | WP_021472904.1 | hypothetical protein | - |
NL395_RS19160 (NL395_19110) | 4066744..4067385 | - | 642 | WP_021472905.1 | LysE family translocator | - |
NL395_RS19165 (NL395_19115) | 4067584..4068462 | + | 879 | WP_043427191.1 | prephenate dehydratase | - |
NL395_RS19170 (NL395_19120) | 4068495..4068770 | + | 276 | WP_021472907.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL395_RS19175 (NL395_19125) | 4068767..4069057 | + | 291 | WP_021472908.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL395_RS19180 (NL395_19130) | 4069069..4070046 | - | 978 | WP_021472909.1 | thioredoxin-disulfide reductase | - |
NL395_RS19185 (NL395_19135) | 4070110..4072281 | - | 2172 | WP_069696782.1 | MMPL family transporter | - |
NL395_RS19190 (NL395_19140) | 4072444..4073079 | + | 636 | WP_259362707.1 | MarR family transcriptional regulator | - |
NL395_RS19195 (NL395_19145) | 4073160..4073975 | + | 816 | WP_021474094.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10888.46 Da Isoelectric Point: 10.0347
>T251468 WP_021472908.1 NZ_CP101180:4068767-4069057 [Paenarthrobacter ureafaciens]
VSNSSLEGEPWNIQVTSPALKTFHRLPEKAASAIVEFITGALAGNPHRLSKPLTNELLGMRTARRGDYRVLFTLDIEDHV
LYVHRIQHRADVYKPR
VSNSSLEGEPWNIQVTSPALKTFHRLPEKAASAIVEFITGALAGNPHRLSKPLTNELLGMRTARRGDYRVLFTLDIEDHV
LYVHRIQHRADVYKPR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|