Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 300708..301294 Replicon chromosome
Accession NZ_CP100747
Organism Salmonella enterica subsp. enterica serovar Montevideo strain R17.4849

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag NL707_RS01380 Protein ID WP_000174963.1
Coordinates 300926..301294 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NL707_RS01375 Protein ID WP_001520924.1
Coordinates 300708..300929 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL707_RS01350 (295729) 295729..296838 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NL707_RS01355 (296898) 296898..297824 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL707_RS01360 (297821) 297821..299098 + 1278 WP_000803767.1 branched chain amino acid ABC transporter permease LivM -
NL707_RS01365 (299095) 299095..299862 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL707_RS01370 (299864) 299864..300577 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL707_RS01375 (300708) 300708..300929 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL707_RS01380 (300926) 300926..301294 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL707_RS01385 (301553) 301553..302869 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL707_RS01390 (302974) 302974..303861 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL707_RS01395 (303858) 303858..304703 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL707_RS01400 (304706) 304706..305776 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 297821..306513 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T251339 WP_000174963.1 NZ_CP100747:300926-301294 [Salmonella enterica subsp. enterica serovar Montevideo]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT251339 WP_001520924.1 NZ_CP100747:300708-300929 [Salmonella enterica subsp. enterica serovar Montevideo]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References