Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2483746..2483971 Replicon chromosome
Accession NZ_CP100724
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag NL714_RS12175 Protein ID WP_000813254.1
Coordinates 2483746..2483901 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2483913..2483971 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL714_RS12140 2478853..2479134 - 282 WP_000445513.1 phage holin family protein -
NL714_RS12145 2479124..2479312 - 189 WP_001688615.1 putative holin -
NL714_RS12150 2479306..2479629 - 324 Protein_2380 tellurite/colicin resistance protein -
NL714_RS12155 2481800..2482336 - 537 WP_000640113.1 DUF1133 family protein -
NL714_RS12160 2482333..2482623 - 291 WP_000774470.1 DUF1364 domain-containing protein -
NL714_RS12165 2482623..2483222 - 600 WP_000940751.1 DUF1367 family protein -
NL714_RS12170 2483285..2483455 - 171 WP_000734094.1 hypothetical protein -
NL714_RS12175 2483746..2483901 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2483913..2483971 + 59 - - Antitoxin
NL714_RS12180 2484328..2485260 + 933 WP_254534667.1 hypothetical protein -
NL714_RS12185 2485257..2485811 + 555 WP_001033796.1 hypothetical protein -
NL714_RS12190 2485973..2486302 - 330 WP_001676916.1 DUF977 family protein -
NL714_RS12195 2486346..2486393 - 48 Protein_2389 hypothetical protein -
NL714_RS12200 2486575..2487042 + 468 WP_001227859.1 helix-turn-helix domain-containing protein -
NL714_RS12205 2487427..2487582 + 156 WP_085981757.1 DUF1391 family protein -
NL714_RS12210 2487690..2488211 - 522 WP_000004762.1 super-infection exclusion protein B -
NL714_RS12215 2488649..2488870 + 222 WP_000560208.1 cell division protein FtsZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2478311..2490182 11871


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T251222 WP_000813254.1 NZ_CP100724:c2483901-2483746 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT251222 NZ_CP100724:2483913-2483971 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References