Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3623800..3624420 | Replicon | chromosome |
| Accession | NZ_CP100718 | ||
| Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NL732_RS17845 | Protein ID | WP_001280991.1 |
| Coordinates | 3624202..3624420 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NL732_RS17840 | Protein ID | WP_000344807.1 |
| Coordinates | 3623800..3624174 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL732_RS17830 (3618939) | 3618939..3620132 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL732_RS17835 (3620155) | 3620155..3623304 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NL732_RS17840 (3623800) | 3623800..3624174 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NL732_RS17845 (3624202) | 3624202..3624420 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NL732_RS17850 (3624599) | 3624599..3625150 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NL732_RS17855 (3625268) | 3625268..3625738 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NL732_RS17860 (3625794) | 3625794..3625934 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NL732_RS17865 (3625936) | 3625936..3626199 | - | 264 | WP_000801422.1 | type B 50S ribosomal protein L31 | - |
| NL732_RS17870 (3626424) | 3626424..3627974 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
| NL732_RS17880 (3628205) | 3628205..3628594 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NL732_RS17885 (3628627) | 3628627..3629196 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251202 WP_001280991.1 NZ_CP100718:3624202-3624420 [Salmonella enterica subsp. enterica serovar Weltevreden]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251202 WP_000344807.1 NZ_CP100718:3623800-3624174 [Salmonella enterica subsp. enterica serovar Weltevreden]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|