Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2696256..2696983 | Replicon | chromosome |
| Accession | NZ_CP100698 | ||
| Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.2256 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V7IQW2 |
| Locus tag | NL710_RS13070 | Protein ID | WP_000558158.1 |
| Coordinates | 2696256..2696567 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL710_RS13075 | Protein ID | WP_000561389.1 |
| Coordinates | 2696564..2696983 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL710_RS13035 (2691423) | 2691423..2692145 | - | 723 | WP_000182066.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
| NL710_RS13040 (2692830) | 2692830..2693225 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| NL710_RS13045 (2693554) | 2693554..2694030 | + | 477 | WP_000030944.1 | hypothetical protein | - |
| NL710_RS13050 (2694140) | 2694140..2694334 | + | 195 | WP_023134800.1 | hypothetical protein | - |
| NL710_RS13055 (2694697) | 2694697..2695479 | + | 783 | WP_001747695.1 | DUF2971 domain-containing protein | - |
| NL710_RS13060 (2695533) | 2695533..2695748 | - | 216 | WP_001747696.1 | hypothetical protein | - |
| NL710_RS13065 (2695778) | 2695778..2696077 | - | 300 | WP_000775225.1 | hypothetical protein | - |
| NL710_RS13070 (2696256) | 2696256..2696567 | + | 312 | WP_000558158.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL710_RS13075 (2696564) | 2696564..2696983 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NL710_RS13080 (2697239) | 2697239..2697733 | + | 495 | WP_016419152.1 | glycosyltransferase | - |
| NL710_RS13085 (2697730) | 2697730..2697888 | + | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
| NL710_RS13090 (2698124) | 2698124..2698543 | - | 420 | WP_000354404.1 | GNAT family N-acetyltransferase | - |
| NL710_RS13095 (2698914) | 2698914..2699183 | + | 270 | WP_077905753.1 | hypothetical protein | - |
| NL710_RS13100 (2699349) | 2699349..2699489 | + | 141 | WP_000489598.1 | hypothetical protein | - |
| NL710_RS13105 (2699635) | 2699635..2700177 | - | 543 | Protein_2565 | IS256 family transposase | - |
| NL710_RS13110 (2700197) | 2700197..2700289 | - | 93 | WP_231923105.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2699635..2700312 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.19 Da Isoelectric Point: 10.0279
>T251091 WP_000558158.1 NZ_CP100698:2696256-2696567 [Salmonella enterica subsp. enterica serovar Agona]
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRTVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRTVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT251091 WP_000561389.1 NZ_CP100698:2696564-2696983 [Salmonella enterica subsp. enterica serovar Agona]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|