Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 2696256..2696983 Replicon chromosome
Accession NZ_CP100698
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.2256

Toxin (Protein)


Gene name higB Uniprot ID V7IQW2
Locus tag NL710_RS13070 Protein ID WP_000558158.1
Coordinates 2696256..2696567 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NL710_RS13075 Protein ID WP_000561389.1
Coordinates 2696564..2696983 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL710_RS13035 (2691423) 2691423..2692145 - 723 WP_000182066.1 SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 -
NL710_RS13040 (2692830) 2692830..2693225 + 396 WP_000422887.1 DUF1398 domain-containing protein -
NL710_RS13045 (2693554) 2693554..2694030 + 477 WP_000030944.1 hypothetical protein -
NL710_RS13050 (2694140) 2694140..2694334 + 195 WP_023134800.1 hypothetical protein -
NL710_RS13055 (2694697) 2694697..2695479 + 783 WP_001747695.1 DUF2971 domain-containing protein -
NL710_RS13060 (2695533) 2695533..2695748 - 216 WP_001747696.1 hypothetical protein -
NL710_RS13065 (2695778) 2695778..2696077 - 300 WP_000775225.1 hypothetical protein -
NL710_RS13070 (2696256) 2696256..2696567 + 312 WP_000558158.1 type II toxin-antitoxin system HigB family toxin Toxin
NL710_RS13075 (2696564) 2696564..2696983 + 420 WP_000561389.1 helix-turn-helix domain-containing protein Antitoxin
NL710_RS13080 (2697239) 2697239..2697733 + 495 WP_016419152.1 glycosyltransferase -
NL710_RS13085 (2697730) 2697730..2697888 + 159 WP_023165344.1 lipopolysaccharide 1,2-N-acetylglucosaminetransferase -
NL710_RS13090 (2698124) 2698124..2698543 - 420 WP_000354404.1 GNAT family N-acetyltransferase -
NL710_RS13095 (2698914) 2698914..2699183 + 270 WP_077905753.1 hypothetical protein -
NL710_RS13100 (2699349) 2699349..2699489 + 141 WP_000489598.1 hypothetical protein -
NL710_RS13105 (2699635) 2699635..2700177 - 543 Protein_2565 IS256 family transposase -
NL710_RS13110 (2700197) 2700197..2700289 - 93 WP_231923105.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2699635..2700312 677


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12398.19 Da        Isoelectric Point: 10.0279

>T251091 WP_000558158.1 NZ_CP100698:2696256-2696567 [Salmonella enterica subsp. enterica serovar Agona]
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRTVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15301.49 Da        Isoelectric Point: 4.6286

>AT251091 WP_000561389.1 NZ_CP100698:2696564-2696983 [Salmonella enterica subsp. enterica serovar Agona]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V7IQW2

Antitoxin

Source ID Structure

References