Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4112211..4112727 | Replicon | chromosome |
| Accession | NZ_CP100678 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A5U7R3Q6 |
| Locus tag | NL708_RS19925 | Protein ID | WP_023243277.1 |
| Coordinates | 4112211..4112495 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NL708_RS19930 | Protein ID | WP_000212724.1 |
| Coordinates | 4112485..4112727 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL708_RS19910 (4107327) | 4107327..4108979 | + | 1653 | WP_023243275.1 | alpha,alpha-phosphotrehalase | - |
| NL708_RS19915 (4109388) | 4109388..4111526 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NL708_RS19920 (4111743) | 4111743..4112207 | + | 465 | WP_023243276.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NL708_RS19925 (4112211) | 4112211..4112495 | - | 285 | WP_023243277.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL708_RS19930 (4112485) | 4112485..4112727 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NL708_RS19935 (4112805) | 4112805..4114718 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
| NL708_RS19940 (4114735) | 4114735..4115475 | - | 741 | WP_023243278.1 | KDGP aldolase family protein | - |
| NL708_RS19945 (4115472) | 4115472..4116590 | - | 1119 | WP_023243279.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NL708_RS19950 (4116574) | 4116574..4117707 | - | 1134 | WP_023243280.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10801.62 Da Isoelectric Point: 9.6730
>T250979 WP_023243277.1 NZ_CP100678:c4112495-4112211 [Salmonella enterica subsp. enterica serovar Anatum]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5U7R3Q6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |