Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 315808..316394 | Replicon | chromosome |
| Accession | NZ_CP100678 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | Q57IR9 |
| Locus tag | NL708_RS01455 | Protein ID | WP_000174963.1 |
| Coordinates | 316026..316394 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | V7IU48 |
| Locus tag | NL708_RS01450 | Protein ID | WP_001522145.1 |
| Coordinates | 315808..316029 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL708_RS01425 (310829) | 310829..311938 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NL708_RS01430 (311998) | 311998..312924 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NL708_RS01435 (312921) | 312921..314198 | + | 1278 | WP_110962138.1 | branched chain amino acid ABC transporter permease LivM | - |
| NL708_RS01440 (314195) | 314195..314962 | + | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NL708_RS01445 (314964) | 314964..315677 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NL708_RS01450 (315808) | 315808..316029 | + | 222 | WP_001522145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL708_RS01455 (316026) | 316026..316394 | + | 369 | WP_000174963.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NL708_RS01460 (316653) | 316653..317969 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NL708_RS01465 (318074) | 318074..318961 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NL708_RS01470 (318958) | 318958..319803 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NL708_RS01475 (319805) | 319805..320875 | + | 1071 | WP_023243433.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 305587..321612 | 16025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13573.85 Da Isoelectric Point: 6.7252
>T250966 WP_000174963.1 NZ_CP100678:316026-316394 [Salmonella enterica subsp. enterica serovar Anatum]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|