Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 63367..63914 Replicon plasmid pLH09-a-A
Accession NZ_CP100545
Organism Escherichia coli strain LH09-a

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag NLZ06_RS22625 Protein ID WP_001384452.1
Coordinates 63367..63645 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag NLZ06_RS22630 Protein ID WP_000079941.1
Coordinates 63645..63914 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ06_RS22595 (58797) 58797..59057 + 261 WP_000343091.1 hypothetical protein -
NLZ06_RS22600 (59054) 59054..59644 + 591 WP_001350923.1 hypothetical protein -
NLZ06_RS22605 (59706) 59706..59921 - 216 Protein_52 DUF6404 family protein -
NLZ06_RS22610 (60050) 60050..60385 + 336 WP_001080729.1 colicin 1A immunity protein -
NLZ06_RS22615 (60407) 60407..62287 - 1881 WP_001610315.1 colicin Ia central receptor-binding domain-containing protein -
NLZ06_RS22620 (62473) 62473..63321 - 849 WP_001057989.1 3'-5' exonuclease -
NLZ06_RS22625 (63367) 63367..63645 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
NLZ06_RS22630 (63645) 63645..63914 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NLZ06_RS22635 (63987) 63987..64127 - 141 WP_012512742.1 hypothetical protein -
NLZ06_RS22640 (64830) 64830..65687 - 858 WP_001610316.1 incFII family plasmid replication initiator RepA -
NLZ06_RS22645 (65680) 65680..65727 - 48 WP_077822033.1 hypothetical protein -
NLZ06_RS22650 (65718) 65718..65954 + 237 WP_223368648.1 replication protein RepA -
NLZ06_RS22655 (65980) 65980..66240 - 261 WP_000083818.1 replication regulatory protein RepA -
NLZ06_RS22660 (66479) 66479..67069 - 591 WP_000766807.1 DUF2726 domain-containing protein -
NLZ06_RS22665 (67107) 67107..67316 - 210 WP_001610317.1 hemolysin expression modulator Hha -
NLZ06_RS22670 (67362) 67362..67823 - 462 WP_106508624.1 thermonuclease family protein -
NLZ06_RS22675 (68023) 68023..68274 - 252 WP_001372275.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN 1..135017 135017


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T250840 WP_001384452.1 NZ_CP100545:c63645-63367 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT250840 WP_000079941.1 NZ_CP100545:c63914-63645 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References