Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 589125..589924 | Replicon | chromosome |
| Accession | NZ_CP100544 | ||
| Organism | Escherichia coli strain LH09-a | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | NLZ06_RS02890 | Protein ID | WP_000347267.1 |
| Coordinates | 589125..589589 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NLZ06_RS02895 | Protein ID | WP_001307405.1 |
| Coordinates | 589589..589924 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ06_RS02860 (584126) | 584126..584560 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NLZ06_RS02865 (584578) | 584578..585456 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NLZ06_RS02870 (585446) | 585446..586225 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NLZ06_RS02875 (586236) | 586236..586709 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NLZ06_RS02880 (586732) | 586732..588012 | - | 1281 | WP_000681936.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NLZ06_RS02885 (588261) | 588261..589070 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NLZ06_RS02890 (589125) | 589125..589589 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NLZ06_RS02895 (589589) | 589589..589924 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NLZ06_RS02900 (590073) | 590073..591644 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| NLZ06_RS02905 (592019) | 592019..593353 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NLZ06_RS02910 (593369) | 593369..594139 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 589125..600580 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T250824 WP_000347267.1 NZ_CP100544:c589589-589125 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |