Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 692259..692952 | Replicon | chromosome |
| Accession | NZ_CP100525 | ||
| Organism | Escherichia coli strain LH13-b | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | NLZ09_RS03405 | Protein ID | WP_000415584.1 |
| Coordinates | 692259..692555 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NLZ09_RS03410 | Protein ID | WP_000650107.1 |
| Coordinates | 692557..692952 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ09_RS03370 (687347) | 687347..687661 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| NLZ09_RS03375 (687692) | 687692..688273 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| NLZ09_RS03380 (688592) | 688592..688924 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| NLZ09_RS03385 (688970) | 688970..690319 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| NLZ09_RS03390 (690316) | 690316..690975 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| NLZ09_RS03395 (691127) | 691127..691519 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NLZ09_RS03400 (691572) | 691572..692054 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NLZ09_RS03405 (692259) | 692259..692555 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NLZ09_RS03410 (692557) | 692557..692952 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NLZ09_RS03415 (693085) | 693085..694692 | + | 1608 | WP_136699267.1 | ABC transporter substrate-binding protein | - |
| NLZ09_RS03420 (694830) | 694830..697088 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T250755 WP_000415584.1 NZ_CP100525:692259-692555 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT250755 WP_000650107.1 NZ_CP100525:692557-692952 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|