Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1261169..1261788 Replicon chromosome
Accession NZ_CP100515
Organism Klebsiella pneumoniae strain LH35-d

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NLZ11_RS06035 Protein ID WP_002892050.1
Coordinates 1261169..1261387 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NLZ11_RS06040 Protein ID WP_002892066.1
Coordinates 1261414..1261788 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ11_RS06000 (NLZ11_06000) 1257216..1257479 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NLZ11_RS06005 (NLZ11_06005) 1257479..1257619 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NLZ11_RS06010 (NLZ11_06010) 1257616..1258314 - 699 WP_002892021.1 GNAT family protein -
NLZ11_RS06015 (NLZ11_06015) 1258415..1259866 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NLZ11_RS06020 (NLZ11_06020) 1259841..1260311 - 471 WP_002892026.1 YlaC family protein -
NLZ11_RS06025 (NLZ11_06025) 1260332..1260472 + 141 WP_004147370.1 hypothetical protein -
NLZ11_RS06030 (NLZ11_06030) 1260444..1261010 - 567 WP_002892030.1 maltose O-acetyltransferase -
NLZ11_RS06035 (NLZ11_06035) 1261169..1261387 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NLZ11_RS06040 (NLZ11_06040) 1261414..1261788 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NLZ11_RS06045 (NLZ11_06045) 1262274..1265420 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NLZ11_RS06050 (NLZ11_06050) 1265443..1266636 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250727 WP_002892050.1 NZ_CP100515:c1261387-1261169 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250727 WP_002892066.1 NZ_CP100515:c1261788-1261414 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References