Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2867064..2867589 | Replicon | chromosome |
Accession | NZ_CP100443 | ||
Organism | Streptomyces rimosus subsp. rimosus strain DV3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | L8EGB8 |
Locus tag | SRIMDV3_RS11795 | Protein ID | WP_003987428.1 |
Coordinates | 2867326..2867589 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L8ED57 |
Locus tag | SRIMDV3_RS11790 | Protein ID | WP_003987429.1 |
Coordinates | 2867064..2867333 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRIMDV3_RS11765 (SRIMDV3_11825) | 2862096..2862818 | + | 723 | WP_030181983.1 | PIG-L deacetylase family protein | - |
SRIMDV3_RS11770 (SRIMDV3_11830) | 2862806..2863774 | - | 969 | WP_003982326.1 | alpha/beta hydrolase | - |
SRIMDV3_RS11775 (SRIMDV3_11835) | 2863904..2864413 | + | 510 | WP_003982327.1 | hypothetical protein | - |
SRIMDV3_RS11780 (SRIMDV3_11840) | 2864454..2865038 | + | 585 | WP_003982328.1 | Uma2 family endonuclease | - |
SRIMDV3_RS11785 (SRIMDV3_11845) | 2865080..2866760 | - | 1681 | Protein_2341 | IS1182-like element ISSdi1 family transposase | - |
SRIMDV3_RS11790 (SRIMDV3_11855) | 2867064..2867333 | + | 270 | WP_003987429.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
SRIMDV3_RS11795 (SRIMDV3_11860) | 2867326..2867589 | + | 264 | WP_003987428.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SRIMDV3_RS11800 (SRIMDV3_11865) | 2867724..2868812 | - | 1089 | WP_003987427.1 | redox-regulated ATPase YchF | - |
SRIMDV3_RS11805 (SRIMDV3_11870) | 2869355..2870062 | + | 708 | WP_063604328.1 | hypothetical protein | - |
SRIMDV3_RS11810 (SRIMDV3_11875) | 2870028..2870900 | - | 873 | WP_078586864.1 | ROK family protein | - |
SRIMDV3_RS11815 (SRIMDV3_11880) | 2870986..2872029 | - | 1044 | WP_078586862.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10084.54 Da Isoelectric Point: 8.5041
>T250564 WP_003987428.1 NZ_CP100443:2867326-2867589 [Streptomyces rimosus subsp. rimosus]
VSEYRTVFRPEAQTELRKVPRDMALRILAKLTELETDPLGFNTTALVSQPDRRRLRVGDYRLIYTIDNGELVVWVVHVGH
RSTVYDA
VSEYRTVFRPEAQTELRKVPRDMALRILAKLTELETDPLGFNTTALVSQPDRRRLRVGDYRLIYTIDNGELVVWVVHVGH
RSTVYDA
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|