Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 4787470..4788004 | Replicon | chromosome |
| Accession | NZ_CP100442 | ||
| Organism | Flavobacterium plurextorum strain RSG-18 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NLG42_RS20775 | Protein ID | WP_257682215.1 |
| Coordinates | 4787470..4787763 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | NLG42_RS20780 | Protein ID | WP_089056144.1 |
| Coordinates | 4787756..4788004 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG42_RS20745 (NLG42_20720) | 4782835..4783524 | + | 690 | WP_089056139.1 | response regulator transcription factor | - |
| NLG42_RS20750 (NLG42_20725) | 4783557..4784099 | - | 543 | WP_089056140.1 | hypothetical protein | - |
| NLG42_RS20755 (NLG42_20730) | 4784190..4785107 | - | 918 | WP_257682214.1 | 2-dehydropantoate 2-reductase | - |
| NLG42_RS20760 (NLG42_20735) | 4785223..4786473 | - | 1251 | WP_099718953.1 | cation:dicarboxylase symporter family transporter | - |
| NLG42_RS20770 (NLG42_20745) | 4786951..4787244 | + | 294 | WP_089056142.1 | hypothetical protein | - |
| NLG42_RS20775 (NLG42_20750) | 4787470..4787763 | - | 294 | WP_257682215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLG42_RS20780 (NLG42_20755) | 4787756..4788004 | - | 249 | WP_089056144.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| NLG42_RS20785 (NLG42_20760) | 4788104..4788553 | - | 450 | WP_257682216.1 | nuclear transport factor 2 family protein | - |
| NLG42_RS20790 (NLG42_20765) | 4788611..4789405 | - | 795 | WP_099718958.1 | peptidase | - |
| NLG42_RS20795 (NLG42_20770) | 4789514..4790170 | + | 657 | WP_123922143.1 | hypothetical protein | - |
| NLG42_RS20800 (NLG42_20775) | 4790231..4791316 | + | 1086 | WP_089056148.1 | DNA polymerase III subunit gamma/tau | - |
| NLG42_RS20805 (NLG42_20780) | 4791390..4791542 | - | 153 | WP_257682217.1 | hypothetical protein | - |
| NLG42_RS20810 (NLG42_20785) | 4791526..4791969 | + | 444 | WP_257682218.1 | DNA polymerase III subunit gamma/tau | - |
| NLG42_RS20815 (NLG42_20790) | 4792047..4792625 | - | 579 | WP_099718961.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11443.97 Da Isoelectric Point: 4.8258
>T250563 WP_257682215.1 NZ_CP100442:c4787763-4787470 [Flavobacterium plurextorum]
MAKYHFTNKAVEDLADIWNYTFDEWSENQADKYYLLLLDSCQELAENPNLGKKYDTVAESLFGFKSNLHILFYQIISNTE
IEVVRILHGRMDLKSKF
MAKYHFTNKAVEDLADIWNYTFDEWSENQADKYYLLLLDSCQELAENPNLGKKYDTVAESLFGFKSNLHILFYQIISNTE
IEVVRILHGRMDLKSKF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|