Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3441833..3442470 | Replicon | chromosome |
| Accession | NZ_CP100391 | ||
| Organism | Bacillus velezensis strain PHP1601 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NJ242_RS16955 | Protein ID | WP_003156187.1 |
| Coordinates | 3441833..3442183 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | NJ242_RS16960 | Protein ID | WP_003156188.1 |
| Coordinates | 3442189..3442470 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NJ242_RS16915 (NJ242_16915) | 3436873..3437475 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
| NJ242_RS16920 (NJ242_16920) | 3437475..3438263 | - | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
| NJ242_RS16925 (NJ242_16925) | 3438229..3438711 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| NJ242_RS16930 (NJ242_16930) | 3438708..3439037 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| NJ242_RS16935 (NJ242_16935) | 3439101..3440108 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| NJ242_RS16940 (NJ242_16940) | 3440120..3440521 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| NJ242_RS16945 (NJ242_16945) | 3440524..3440889 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| NJ242_RS16950 (NJ242_16950) | 3440894..3441715 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| NJ242_RS16955 (NJ242_16955) | 3441833..3442183 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NJ242_RS16960 (NJ242_16960) | 3442189..3442470 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NJ242_RS16965 (NJ242_16965) | 3442590..3443759 | - | 1170 | WP_032873001.1 | alanine racemase | - |
| NJ242_RS16970 (NJ242_16970) | 3443876..3444883 | - | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
| NJ242_RS16975 (NJ242_16975) | 3445048..3445413 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
| NJ242_RS16980 (NJ242_16980) | 3445506..3446105 | + | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T250521 WP_003156187.1 NZ_CP100391:c3442183-3441833 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|