Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4103133..4103752 Replicon chromosome
Accession NZ_CP100072
Organism Klebsiella pneumoniae strain RJKP41

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL01_RS20025 Protein ID WP_002892050.1
Coordinates 4103534..4103752 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL01_RS20020 Protein ID WP_002892066.1
Coordinates 4103133..4103507 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL01_RS20010 (4098285) 4098285..4099478 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL01_RS20015 (4099501) 4099501..4102647 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL01_RS20020 (4103133) 4103133..4103507 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL01_RS20025 (4103534) 4103534..4103752 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL01_RS20030 (4103911) 4103911..4104477 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL01_RS20035 (4104449) 4104449..4104589 - 141 WP_004147370.1 hypothetical protein -
NIL01_RS20040 (4104610) 4104610..4105080 + 471 WP_002892026.1 YlaC family protein -
NIL01_RS20045 (4105055) 4105055..4106506 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL01_RS20050 (4106607) 4106607..4107305 + 699 WP_002892021.1 GNAT family protein -
NIL01_RS20055 (4107302) 4107302..4107442 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL01_RS20060 (4107442) 4107442..4107705 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250040 WP_002892050.1 NZ_CP100072:4103534-4103752 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250040 WP_002892066.1 NZ_CP100072:4103133-4103507 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References