Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 2406269..2406873 | Replicon | chromosome |
Accession | NZ_CP099912 | ||
Organism | Escherichia albertii strain 105_1_LWG_A |
Toxin (Protein)
Gene name | doc | Uniprot ID | B1EM00 |
Locus tag | NIY85_RS11970 | Protein ID | WP_000638401.1 |
Coordinates | 2406487..2406873 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | B1ELZ9 |
Locus tag | NIY85_RS11965 | Protein ID | WP_001195490.1 |
Coordinates | 2406269..2406490 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY85_RS11945 (2402437) | 2402437..2403351 | + | 915 | WP_024164792.1 | bestrophin family protein | - |
NIY85_RS11950 (2403355) | 2403355..2404113 | - | 759 | WP_025239009.1 | trans-aconitate 2-methyltransferase | - |
NIY85_RS11955 (2404703) | 2404703..2405029 | + | 327 | Protein_2343 | site-specific integrase | - |
NIY85_RS11960 (2405026) | 2405026..2406069 | + | 1044 | WP_256876820.1 | hypothetical protein | - |
NIY85_RS11965 (2406269) | 2406269..2406490 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NIY85_RS11970 (2406487) | 2406487..2406873 | + | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NIY85_RS11975 (2406953) | 2406953..2407396 | - | 444 | WP_256878478.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
NIY85_RS11980 (2407762) | 2407762..2409414 | - | 1653 | WP_244251443.1 | ESPR-type extended signal peptide-containing protein | - |
NIY85_RS11985 (2410104) | 2410104..2410325 | + | 222 | Protein_2349 | sulfatase | - |
NIY85_RS11990 (2410417) | 2410417..2411645 | + | 1229 | WP_112017357.1 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T249955 WP_000638401.1 NZ_CP099912:2406487-2406873 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T5VDW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6PD20 |