Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 4036593..4037393 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NIZ20_RS19695 | Protein ID | WP_059225129.1 |
| Coordinates | 4036593..4037120 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIZ20_RS19700 | Protein ID | WP_001277106.1 |
| Coordinates | 4037127..4037393 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS19670 (4031668) | 4031668..4032435 | - | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NIZ20_RS19675 (4032432) | 4032432..4033709 | - | 1278 | WP_059225128.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIZ20_RS19680 (4033706) | 4033706..4034632 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIZ20_RS19685 (4034680) | 4034680..4035789 | - | 1110 | Protein_3838 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIZ20_RS19690 (4036213) | 4036213..4036596 | + | 384 | WP_000778776.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIZ20_RS19695 (4036593) | 4036593..4037120 | - | 528 | WP_059225129.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIZ20_RS19700 (4037127) | 4037127..4037393 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIZ20_RS19705 (4037543) | 4037543..4038646 | - | 1104 | WP_072248450.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIZ20_RS19710 (4038918) | 4038918..4039772 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NIZ20_RS19715 (4040017) | 4040017..4041075 | - | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| NIZ20_RS19720 (4041068) | 4041068..4041736 | - | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19690.60 Da Isoelectric Point: 6.9585
>T249684 WP_059225129.1 NZ_CP099883:c4037120-4036593 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|