Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 71647..72248 | Replicon | plasmid plas2 |
| Accession | NZ_CP099870 | ||
| Organism | Escherichia albertii strain 254_1_EW_B | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | NIZ25_RS24485 | Protein ID | WP_001216045.1 |
| Coordinates | 71868..72248 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NIZ25_RS24480 | Protein ID | WP_001190712.1 |
| Coordinates | 71647..71868 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ25_RS24470 (NIZ25_24445) | 68685..69911 | - | 1227 | WP_256876192.1 | restriction endonuclease subunit S | - |
| NIZ25_RS24475 (NIZ25_24450) | 69908..71464 | - | 1557 | WP_073511017.1 | type I restriction-modification system subunit M | - |
| NIZ25_RS24480 (NIZ25_24455) | 71647..71868 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NIZ25_RS24485 (NIZ25_24460) | 71868..72248 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NIZ25_RS24490 (NIZ25_24465) | 72253..72432 | + | 180 | WP_000113019.1 | hypothetical protein | - |
| NIZ25_RS24495 (NIZ25_24470) | 72460..73503 | + | 1044 | WP_256876191.1 | DUF968 domain-containing protein | - |
| NIZ25_RS24500 (NIZ25_24475) | 73592..74044 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
| NIZ25_RS24505 (NIZ25_24480) | 74131..75324 | + | 1194 | WP_000219618.1 | hypothetical protein | - |
| NIZ25_RS24510 (NIZ25_24485) | 75324..76808 | + | 1485 | WP_000124159.1 | hypothetical protein | - |
| NIZ25_RS24515 (NIZ25_24490) | 76892..77122 | + | 231 | Protein_79 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..122706 | 122706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T249564 WP_001216045.1 NZ_CP099870:71868-72248 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |