Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 64084..64727 | Replicon | plasmid plas1 |
| Accession | NZ_CP099869 | ||
| Organism | Escherichia albertii strain 254_1_EW_B | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NIZ25_RS23920 | Protein ID | WP_256876211.1 |
| Coordinates | 64311..64727 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIZ25_RS23915 | Protein ID | WP_256876210.1 |
| Coordinates | 64084..64314 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ25_RS23890 (60157) | 60157..60684 | - | 528 | WP_000203268.1 | colicin B immunity protein | - |
| NIZ25_RS23895 (60927) | 60927..61742 | + | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
| NIZ25_RS23900 (61792) | 61792..62145 | - | 354 | WP_000864812.1 | colicin M immunity protein | - |
| NIZ25_RS23905 (62318) | 62318..63100 | - | 783 | WP_021533580.1 | site-specific integrase | - |
| NIZ25_RS23910 (63102) | 63102..63515 | - | 414 | WP_000465043.1 | hypothetical protein | - |
| NIZ25_RS23915 (64084) | 64084..64314 | + | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIZ25_RS23920 (64311) | 64311..64727 | + | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIZ25_RS23925 (64867) | 64867..65847 | + | 981 | WP_256876212.1 | hypothetical protein | - |
| NIZ25_RS23930 (66055) | 66055..67626 | - | 1572 | WP_256876213.1 | ATP-binding protein | - |
| NIZ25_RS23935 (67945) | 67945..68214 | + | 270 | WP_256876214.1 | hypothetical protein | - |
| NIZ25_RS23940 (68202) | 68202..68798 | + | 597 | WP_256876215.1 | hypothetical protein | - |
| NIZ25_RS23945 (69335) | 69335..69676 | + | 342 | Protein_86 | protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 | 1..105541 | 105541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T249563 WP_256876211.1 NZ_CP099869:64311-64727 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|