Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2385352..2385878 | Replicon | chromosome |
| Accession | NZ_CP099868 | ||
| Organism | Escherichia albertii strain 254_1_EW_B | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NIZ25_RS11675 | Protein ID | WP_000323025.1 |
| Coordinates | 2385591..2385878 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NIZ25_RS11670 | Protein ID | WP_000534858.1 |
| Coordinates | 2385352..2385591 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ25_RS11630 (2380538) | 2380538..2380765 | + | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
| NIZ25_RS11635 (2380749) | 2380749..2381270 | + | 522 | WP_000705349.1 | toxin YdaT family protein | - |
| NIZ25_RS11640 (2381251) | 2381251..2382216 | + | 966 | WP_000054504.1 | hypothetical protein | - |
| NIZ25_RS11645 (2382257) | 2382257..2382676 | + | 420 | WP_001151196.1 | DUF977 family protein | - |
| NIZ25_RS11650 (2382731) | 2382731..2383780 | + | 1050 | Protein_2274 | ISNCY family transposase | - |
| NIZ25_RS11655 (2383901) | 2383901..2384050 | + | 150 | WP_180302674.1 | protein YdfW | - |
| NIZ25_RS11660 (2384487) | 2384487..2384819 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
| NIZ25_RS11665 (2385022) | 2385022..2385327 | - | 306 | WP_071527819.1 | protein YdfV | - |
| NIZ25_RS11670 (2385352) | 2385352..2385591 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NIZ25_RS11675 (2385591) | 2385591..2385878 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NIZ25_RS11680 (2385950) | 2385950..2386105 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NIZ25_RS11685 (2386322) | 2386322..2386573 | + | 252 | WP_000980994.1 | protein Rem | - |
| NIZ25_RS11690 (2386640) | 2386640..2386918 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| NIZ25_RS11695 (2386920) | 2386920..2387969 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| NIZ25_RS11700 (2387983) | 2387983..2388735 | + | 753 | WP_001047135.1 | antitermination protein | - |
| NIZ25_RS11705 (2389013) | 2389013..2389102 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| NIZ25_RS11710 (2389157) | 2389157..2389369 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| NIZ25_RS11715 (2389670) | 2389670..2389885 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NIZ25_RS11720 (2390249) | 2390249..2390419 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2362263..2423985 | 61722 | |
| - | inside | Prophage | - | - | 2368906..2423985 | 55079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249546 WP_000323025.1 NZ_CP099868:2385591-2385878 [Escherichia albertii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|