Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 298429..299229 | Replicon | chromosome |
| Accession | NZ_CP099868 | ||
| Organism | Escherichia albertii strain 254_1_EW_B | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NIZ25_RS01380 | Protein ID | WP_059225129.1 |
| Coordinates | 298702..299229 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIZ25_RS01375 | Protein ID | WP_001277106.1 |
| Coordinates | 298429..298695 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ25_RS01355 (294086) | 294086..294754 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
| NIZ25_RS01360 (294747) | 294747..295805 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| NIZ25_RS01365 (296050) | 296050..296904 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NIZ25_RS01370 (297176) | 297176..298279 | + | 1104 | WP_072248450.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIZ25_RS01375 (298429) | 298429..298695 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIZ25_RS01380 (298702) | 298702..299229 | + | 528 | WP_059225129.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIZ25_RS01385 (299226) | 299226..299609 | - | 384 | WP_000778776.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIZ25_RS01390 (300033) | 300033..301142 | + | 1110 | Protein_274 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIZ25_RS01395 (301190) | 301190..302116 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIZ25_RS01400 (302113) | 302113..303390 | + | 1278 | WP_059225128.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIZ25_RS01405 (303387) | 303387..304154 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19690.60 Da Isoelectric Point: 6.9585
>T249538 WP_059225129.1 NZ_CP099868:298702-299229 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|