Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2782080..2782682 | Replicon | chromosome |
| Accession | NZ_CP099752 | ||
| Organism | Escherichia coli strain 806883-11-2019 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NHF43_RS13365 | Protein ID | WP_000897305.1 |
| Coordinates | 2782371..2782682 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NHF43_RS13360 | Protein ID | WP_000356397.1 |
| Coordinates | 2782080..2782370 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF43_RS13335 (2778025) | 2778025..2778927 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NHF43_RS13340 (2778924) | 2778924..2779559 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NHF43_RS13345 (2779556) | 2779556..2780485 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| NHF43_RS13350 (2780815) | 2780815..2781057 | - | 243 | WP_001087409.1 | protein YiiF | - |
| NHF43_RS13355 (2781276) | 2781276..2781494 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NHF43_RS13360 (2782080) | 2782080..2782370 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NHF43_RS13365 (2782371) | 2782371..2782682 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NHF43_RS13370 (2782911) | 2782911..2783819 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| NHF43_RS13375 (2783883) | 2783883..2784824 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NHF43_RS13380 (2784869) | 2784869..2785306 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NHF43_RS13385 (2785303) | 2785303..2786175 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NHF43_RS13390 (2786169) | 2786169..2786768 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| NHF43_RS13395 (2786867) | 2786867..2787652 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T249406 WP_000897305.1 NZ_CP099752:c2782682-2782371 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|