Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3560363..3561063 | Replicon | chromosome |
| Accession | NZ_CP099625 | ||
| Organism | Paraburkholderia fungorum strain OTU2BAGNBA1 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | A0A2T1AWY4 |
| Locus tag | NFE55_RS38630 | Protein ID | WP_030100731.1 |
| Coordinates | 3560363..3560659 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | NFE55_RS38635 | Protein ID | WP_028197207.1 |
| Coordinates | 3560662..3561063 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFE55_RS38610 (NFE55_38615) | 3555690..3555959 | + | 270 | WP_028197212.1 | DUF4148 domain-containing protein | - |
| NFE55_RS38615 (NFE55_38620) | 3556067..3557158 | + | 1092 | WP_252890149.1 | catalase family peroxidase | - |
| NFE55_RS38620 (NFE55_38625) | 3557155..3557694 | + | 540 | WP_046570668.1 | cytochrome b | - |
| NFE55_RS38625 (NFE55_38630) | 3557691..3560195 | - | 2505 | WP_046570655.1 | FAD-dependent oxidoreductase | - |
| NFE55_RS38630 (NFE55_38635) | 3560363..3560659 | + | 297 | WP_030100731.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| NFE55_RS38635 (NFE55_38640) | 3560662..3561063 | + | 402 | WP_028197207.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| NFE55_RS38640 (NFE55_38645) | 3561169..3561948 | + | 780 | WP_028197206.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NFE55_RS38645 (NFE55_38650) | 3562138..3565620 | + | 3483 | WP_252890150.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10739.53 Da Isoelectric Point: 7.8545
>T249273 WP_030100731.1 NZ_CP099625:3560363-3560659 [Paraburkholderia fungorum]
MEKSTPHCKLAEVQSLARAGNIRITKSAVIGAAALGLGPAAIIETLLSLERGNFRKSMTTYADHRVWQDVYCAVTEAGMV
YLKLTVIDDVLVVSFKEW
MEKSTPHCKLAEVQSLARAGNIRITKSAVIGAAALGLGPAAIIETLLSLERGNFRKSMTTYADHRVWQDVYCAVTEAGMV
YLKLTVIDDVLVVSFKEW
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14738.86 Da Isoelectric Point: 5.0016
>AT249273 WP_028197207.1 NZ_CP099625:3560662-3561063 [Paraburkholderia fungorum]
MKCPNCGAAELVRDTRNMRYVYKGETAVFEAVTGDYCPACDEAVLDIDEATRTGQMMLAFNKEVNASQVDPAFIAAVRKK
LDLDQREAAEIFGGGVNAFSRYENGKTRPPLALIKLLKVLDRHPELLEEVRAS
MKCPNCGAAELVRDTRNMRYVYKGETAVFEAVTGDYCPACDEAVLDIDEATRTGQMMLAFNKEVNASQVDPAFIAAVRKK
LDLDQREAAEIFGGGVNAFSRYENGKTRPPLALIKLLKVLDRHPELLEEVRAS
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|