Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1791752..1792583 | Replicon | chromosome |
| Accession | NZ_CP099588 | ||
| Organism | Escherichia coli strain EMG2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | NHF38_RS08515 | Protein ID | WP_000854814.1 |
| Coordinates | 1791752..1792126 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | NHF38_RS08520 | Protein ID | WP_001285584.1 |
| Coordinates | 1792215..1792583 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF38_RS08475 (1787148) | 1787148..1788314 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| NHF38_RS08480 (1788433) | 1788433..1788906 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NHF38_RS08485 (1789104) | 1789104..1790162 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| NHF38_RS08490 (1790334) | 1790334..1790663 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NHF38_RS08495 (1790764) | 1790764..1790898 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| NHF38_RS08500 (1791018) | 1791018..1791146 | + | 129 | Protein_1672 | transposase domain-containing protein | - |
| NHF38_RS08505 (1791435) | 1791435..1791515 | - | 81 | Protein_1673 | hypothetical protein | - |
| NHF38_RS08510 (1791561) | 1791561..1791755 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NHF38_RS08515 (1791752) | 1791752..1792126 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NHF38_RS08520 (1792215) | 1792215..1792583 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NHF38_RS08525 (1792657) | 1792657..1792878 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NHF38_RS08530 (1792941) | 1792941..1793387 | - | 447 | WP_000187523.1 | RadC family protein | - |
| NHF38_RS08535 (1793384) | 1793384..1794916 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T249140 WP_000854814.1 NZ_CP099588:c1792126-1791752 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT249140 WP_001285584.1 NZ_CP099588:c1792583-1792215 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |