Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 85837..86489 | Replicon | chromosome |
| Accession | NZ_CP099542 | ||
| Organism | Pantoea ananatis strain JT8-6 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NG830_RS00425 | Protein ID | WP_033778077.1 |
| Coordinates | 85837..86235 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NG830_RS00430 | Protein ID | WP_028724117.1 |
| Coordinates | 86259..86489 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG830_RS00405 (NG830_00400) | 82724..83395 | - | 672 | WP_221611350.1 | fimbria/pilus periplasmic chaperone | - |
| NG830_RS00410 (NG830_00405) | 83458..84015 | - | 558 | WP_252294282.1 | fimbrial protein | - |
| NG830_RS00415 (NG830_00410) | 84424..84705 | + | 282 | WP_028724120.1 | LuxR C-terminal-related transcriptional regulator | - |
| NG830_RS00420 (NG830_00415) | 84735..85610 | + | 876 | WP_252294280.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NG830_RS00425 (NG830_00420) | 85837..86235 | - | 399 | WP_033778077.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NG830_RS00430 (NG830_00425) | 86259..86489 | - | 231 | WP_028724117.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NG830_RS00435 (NG830_00430) | 87077..88235 | + | 1159 | Protein_86 | IS30 family transposase | - |
| NG830_RS00440 (NG830_00435) | 88719..89273 | - | 555 | WP_263775424.1 | hypothetical protein | - |
| NG830_RS00445 (NG830_00440) | 89327..89491 | - | 165 | Protein_88 | conjugal transfer protein TraF | - |
| NG830_RS00450 (NG830_00445) | 89489..89722 | + | 234 | Protein_89 | TIGR03752 family integrating conjugative element protein | - |
| NG830_RS00455 (NG830_00450) | 89722..89994 | + | 273 | WP_263775425.1 | hypothetical protein | - |
| NG830_RS00460 (NG830_00455) | 89984..90397 | + | 414 | WP_210456553.1 | TIGR03751 family conjugal transfer lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 47091..112090 | 64999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14290.62 Da Isoelectric Point: 7.2161
>T249097 WP_033778077.1 NZ_CP099542:c86235-85837 [Pantoea ananatis]
MLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGASGPKASPRHVQLVDAFCARLDAVLPWDRAAVDAT
TEIKVSLRLAGTPIGPNDTAIAGHAITVGAILVTNNVREFARVPGLALEDWV
MLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGASGPKASPRHVQLVDAFCARLDAVLPWDRAAVDAT
TEIKVSLRLAGTPIGPNDTAIAGHAITVGAILVTNNVREFARVPGLALEDWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|