Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 41871..42508 Replicon plasmid pTT14-5
Accession NZ_CP099476
Organism Roseomonas mucosa strain TT14

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NF552_RS25145 Protein ID WP_073140686.1
Coordinates 42092..42508 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NF552_RS25140 Protein ID WP_073140683.1
Coordinates 41871..42092 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF552_RS25110 (NF552_25110) 37122..37418 - 297 WP_075822075.1 TrbC/VirB2 family protein -
NF552_RS25115 (NF552_25115) 37415..38119 - 705 WP_252572793.1 lytic transglycosylase domain-containing protein -
NF552_RS25120 (NF552_25120) 38150..38473 - 324 WP_252572794.1 hypothetical protein -
NF552_RS25125 (NF552_25125) 39085..39366 + 282 WP_073140675.1 hypothetical protein -
NF552_RS25130 (NF552_25130) 39369..39833 + 465 WP_073140678.1 type II toxin-antitoxin system VapC family toxin -
NF552_RS25135 (NF552_25135) 39843..41744 - 1902 WP_073140681.1 DEAD/DEAH box helicase family protein -
NF552_RS25140 (NF552_25140) 41871..42092 + 222 WP_073140683.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NF552_RS25145 (NF552_25145) 42092..42508 + 417 WP_073140686.1 tRNA(fMet)-specific endonuclease VapC Toxin
NF552_RS25150 (NF552_25150) 42839..43618 - 780 WP_252572795.1 IS21-like element helper ATPase IstB -
NF552_RS25155 (NF552_25155) 43608..45167 - 1560 WP_075822069.1 IS21 family transposase -
NF552_RS25160 (NF552_25160) 45263..45562 - 300 WP_075823694.1 four-helix bundle copper-binding protein -
NF552_RS25165 (NF552_25165) 45996..46454 - 459 WP_184521089.1 DUF411 domain-containing protein -
NF552_RS25170 (NF552_25170) 46451..46939 - 489 WP_075823366.1 Cu(I)-responsive transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..142315 142315


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-54)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15333.65 Da        Isoelectric Point: 8.2930

>T248936 WP_073140686.1 NZ_CP099476:42092-42508 [Roseomonas mucosa]
MLRYLLDTNLCIRVLRDRPQGLRTRFNAEAGSLCISTVVLMELLHGAGKSARPIENRREVERFTARLDVLAFDADAAAHA
GEIRTALERAGQVIGAYDLMIAGHARSRGLVVVTGNLSEFRRVEGLRCEDWLASVQEK

Download         Length: 417 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8344.38 Da        Isoelectric Point: 9.1060

>AT248936 WP_073140683.1 NZ_CP099476:41871-42092 [Roseomonas mucosa]
MTRTTLFQSNRTQAVRLPKGVAFPESVREVSILRDGTRRVIVPADASWDDFFGAPGIDLPDRNQPRAEERERF

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References