Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4813041..4813657 Replicon chromosome
Accession NZ_CP099387
Organism Citrobacter braakii strain RHB08-E3-C01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ49_RS23040 Protein ID WP_016155182.1
Coordinates 4813041..4813415 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ49_RS23045 Protein ID WP_016155181.1
Coordinates 4813415..4813657 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ49_RS23025 (4810544) 4810544..4811446 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFJ49_RS23030 (4811443) 4811443..4812078 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ49_RS23035 (4812075) 4812075..4813004 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ49_RS23040 (4813041) 4813041..4813415 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ49_RS23045 (4813415) 4813415..4813657 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ49_RS23050 (4813863) 4813863..4814792 + 930 WP_279273253.1 alpha/beta hydrolase -
NFJ49_RS23055 (4814877) 4814877..4815188 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFJ49_RS23060 (4815185) 4815185..4815637 + 453 WP_104651900.1 helix-turn-helix domain-containing protein -
NFJ49_RS23065 (4815655) 4815655..4816596 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFJ49_RS23070 (4816641) 4816641..4817078 - 438 WP_131347306.1 D-aminoacyl-tRNA deacylase -
NFJ49_RS23075 (4817075) 4817075..4817947 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ49_RS23080 (4817941) 4817941..4818540 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248831 WP_016155182.1 NZ_CP099387:c4813415-4813041 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248831 WP_016155181.1 NZ_CP099387:c4813657-4813415 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References