Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3674909..3675529 | Replicon | chromosome |
| Accession | NZ_CP099387 | ||
| Organism | Citrobacter braakii strain RHB08-E3-C01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFJ49_RS17810 | Protein ID | WP_002892050.1 |
| Coordinates | 3675311..3675529 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | NFJ49_RS17805 | Protein ID | WP_003021733.1 |
| Coordinates | 3674909..3675283 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ49_RS17795 (3670056) | 3670056..3671249 | + | 1194 | WP_053389373.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ49_RS17800 (3671272) | 3671272..3674421 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
| NFJ49_RS17805 (3674909) | 3674909..3675283 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ49_RS17810 (3675311) | 3675311..3675529 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFJ49_RS17815 (3675710) | 3675710..3676261 | + | 552 | WP_016152072.1 | maltose O-acetyltransferase | - |
| NFJ49_RS17820 (3676378) | 3676378..3676848 | + | 471 | WP_016152071.1 | YlaC family protein | - |
| NFJ49_RS17825 (3676927) | 3676927..3677067 | - | 141 | WP_279273108.1 | type B 50S ribosomal protein L36 | - |
| NFJ49_RS17830 (3677069) | 3677069..3677329 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
| NFJ49_RS17835 (3677518) | 3677518..3679071 | + | 1554 | WP_279273109.1 | EAL domain-containing protein | - |
| NFJ49_RS17840 (3679123) | 3679123..3679476 | - | 354 | WP_080858962.1 | DUF1428 family protein | - |
| NFJ49_RS17845 (3679541) | 3679541..3680170 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248830 WP_002892050.1 NZ_CP099387:3675311-3675529 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248830 WP_003021733.1 NZ_CP099387:3674909-3675283 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |