Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2980136..2980726 | Replicon | chromosome |
Accession | NZ_CP099387 | ||
Organism | Citrobacter braakii strain RHB08-E3-C01 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NFJ49_RS14535 | Protein ID | WP_049041157.1 |
Coordinates | 2980136..2980468 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NFJ49_RS14540 | Protein ID | WP_049041154.1 |
Coordinates | 2980469..2980726 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ49_RS14510 (2975173) | 2975173..2975532 | - | 360 | WP_016156204.1 | purine nucleoside phosphoramidase | - |
NFJ49_RS14515 (2975881) | 2975881..2978067 | + | 2187 | WP_275262164.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
NFJ49_RS14525 (2978401) | 2978401..2979888 | + | 1488 | WP_049040618.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NFJ49_RS14535 (2980136) | 2980136..2980468 | - | 333 | WP_049041157.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFJ49_RS14540 (2980469) | 2980469..2980726 | - | 258 | WP_049041154.1 | antitoxin | Antitoxin |
NFJ49_RS14545 (2981074) | 2981074..2981280 | - | 207 | WP_279272995.1 | helix-turn-helix transcriptional regulator | - |
NFJ49_RS14550 (2981277) | 2981277..2981744 | - | 468 | WP_279272996.1 | hypothetical protein | - |
NFJ49_RS14555 (2982237) | 2982237..2982776 | + | 540 | WP_279272997.1 | AAA family ATPase | - |
NFJ49_RS14560 (2982805) | 2982805..2984442 | + | 1638 | Protein_2859 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11731.54 Da Isoelectric Point: 8.5572
>T248829 WP_049041157.1 NZ_CP099387:c2980468-2980136 [Citrobacter braakii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|