Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4888145..4888905 | Replicon | chromosome |
| Accession | NZ_CP099375 | ||
| Organism | Citrobacter braakii strain RHB25-E4-C05 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFK28_RS23460 | Protein ID | WP_053388923.1 |
| Coordinates | 4888145..4888453 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFK28_RS23465 | Protein ID | WP_053388924.1 |
| Coordinates | 4888453..4888905 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK28_RS23430 (4883813) | 4883813..4884715 | + | 903 | WP_053388921.1 | formate dehydrogenase O subunit beta | - |
| NFK28_RS23435 (4884712) | 4884712..4885347 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFK28_RS23440 (4885344) | 4885344..4886273 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFK28_RS23445 (4886310) | 4886310..4886684 | - | 375 | WP_053388922.1 | type II toxin-antitoxin system VapC family toxin | - |
| NFK28_RS23450 (4886684) | 4886684..4886926 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | - |
| NFK28_RS23455 (4887131) | 4887131..4888060 | + | 930 | WP_149330683.1 | alpha/beta hydrolase | - |
| NFK28_RS23460 (4888145) | 4888145..4888453 | + | 309 | WP_053388923.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFK28_RS23465 (4888453) | 4888453..4888905 | + | 453 | WP_053388924.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NFK28_RS23470 (4888923) | 4888923..4889864 | - | 942 | WP_053388925.1 | fatty acid biosynthesis protein FabY | - |
| NFK28_RS23475 (4889909) | 4889909..4890346 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| NFK28_RS23480 (4890343) | 4890343..4891215 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| NFK28_RS23485 (4891209) | 4891209..4891808 | - | 600 | WP_016157873.1 | glucose-1-phosphatase | - |
| NFK28_RS23490 (4891899) | 4891899..4892789 | - | 891 | WP_053388926.1 | aldose epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4887131..4900493 | 13362 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 12373.55 Da Isoelectric Point: 10.1496
>T248715 WP_053388923.1 NZ_CP099375:4888145-4888453 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHK
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHK
Download Length: 309 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 17014.39 Da Isoelectric Point: 5.9258
>AT248715 WP_053388924.1 NZ_CP099375:4888453-4888905 [Citrobacter braakii]
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEYLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVTLLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEYLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVTLLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|