Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3041645..3042305 | Replicon | chromosome |
| Accession | NZ_CP099375 | ||
| Organism | Citrobacter braakii strain RHB25-E4-C05 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2I8S535 |
| Locus tag | NFK28_RS14890 | Protein ID | WP_053390179.1 |
| Coordinates | 3041952..3042305 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFK28_RS14885 | Protein ID | WP_053390178.1 |
| Coordinates | 3041645..3041947 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK28_RS14865 (3037621) | 3037621..3037773 | + | 153 | WP_165500029.1 | hypothetical protein | - |
| NFK28_RS14875 (3038124) | 3038124..3039386 | + | 1263 | WP_053390176.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NFK28_RS14880 (3040259) | 3040259..3041146 | - | 888 | WP_053390177.1 | integrase domain-containing protein | - |
| NFK28_RS14885 (3041645) | 3041645..3041947 | - | 303 | WP_053390178.1 | XRE family transcriptional regulator | Antitoxin |
| NFK28_RS14890 (3041952) | 3041952..3042305 | - | 354 | WP_053390179.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK28_RS14895 (3042804) | 3042804..3043025 | - | 222 | WP_053390180.1 | helix-turn-helix transcriptional regulator | - |
| NFK28_RS14900 (3043022) | 3043022..3043489 | - | 468 | WP_053390181.1 | hypothetical protein | - |
| NFK28_RS14905 (3044003) | 3044003..3045211 | + | 1209 | WP_149330251.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3036643..3060258 | 23615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13442.36 Da Isoelectric Point: 9.0134
>T248710 WP_053390179.1 NZ_CP099375:c3042305-3041952 [Citrobacter braakii]
VWTIKTTDMFDHWFSSLNDIDRASVLAALLVLREKGPGLSRPYADTLRGSRFSNMKELRIQSRGDPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMIPVADREFTNWLNTIKEKE
VWTIKTTDMFDHWFSSLNDIDRASVLAALLVLREKGPGLSRPYADTLRGSRFSNMKELRIQSRGDPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMIPVADREFTNWLNTIKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|