Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3656058..3656678 Replicon chromosome
Accession NZ_CP099364
Organism Citrobacter braakii strain RHB44-SE-C08

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NFL11_RS18070 Protein ID WP_002892050.1
Coordinates 3656460..3656678 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A7L6U5G9
Locus tag NFL11_RS18065 Protein ID WP_019076175.1
Coordinates 3656058..3656432 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFL11_RS18055 (3651222) 3651222..3654371 + 3150 WP_016152073.1 efflux RND transporter permease AcrB -
NFL11_RS18060 (3654750) 3654750..3655730 - 981 WP_000019402.1 IS5-like element IS5 family transposase -
NFL11_RS18065 (3656058) 3656058..3656432 + 375 WP_019076175.1 Hha toxicity modulator TomB Antitoxin
NFL11_RS18070 (3656460) 3656460..3656678 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NFL11_RS18075 (3656859) 3656859..3657410 + 552 WP_279268202.1 maltose O-acetyltransferase -
NFL11_RS18080 (3657527) 3657527..3657997 + 471 WP_016152071.1 YlaC family protein -
NFL11_RS18085 (3658076) 3658076..3658216 - 141 WP_005125190.1 type B 50S ribosomal protein L36 -
NFL11_RS18090 (3658218) 3658218..3658478 - 261 WP_016152070.1 type B 50S ribosomal protein L31 -
NFL11_RS18095 (3658667) 3658667..3660220 + 1554 WP_016155873.1 EAL domain-containing protein -
NFL11_RS18100 (3660272) 3660272..3660625 - 354 WP_003831033.1 DUF1428 family protein -
NFL11_RS18105 (3660690) 3660690..3661319 - 630 WP_016155872.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 3654750..3655730 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T248637 WP_002892050.1 NZ_CP099364:3656460-3656678 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14413.20 Da        Isoelectric Point: 5.5653

>AT248637 WP_019076175.1 NZ_CP099364:3656058-3656432 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A7L6U5G9

References