Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
| Location | 2501211..2501434 | Replicon | chromosome |
| Accession | NZ_CP099351 | ||
| Organism | Escherichia marmotae strain RHB02-E4-C07 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | NFJ26_RS11805 | Protein ID | WP_000170963.1 |
| Coordinates | 2501327..2501434 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 2501211..2501277 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ26_RS11780 | 2496491..2497885 | - | 1395 | WP_000087125.1 | YchO/YchP family invasin | - |
| NFJ26_RS11785 | 2498069..2498422 | + | 354 | WP_001169672.1 | DsrE/F sulfur relay family protein YchN | - |
| NFJ26_RS11790 | 2498466..2499161 | - | 696 | WP_016248767.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| NFJ26_RS11795 | 2499319..2499549 | - | 231 | WP_001146437.1 | putative cation transport regulator ChaB | - |
| NFJ26_RS11800 | 2499818..2500918 | + | 1101 | WP_010375735.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2501211..2501277 | - | 67 | - | - | Antitoxin |
| NFJ26_RS11805 | 2501327..2501434 | + | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| NFJ26_RS11810 | 2501614..2502468 | - | 855 | WP_000811071.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| NFJ26_RS11815 | 2502504..2503313 | - | 810 | WP_001257034.1 | invasion regulator SirB1 | - |
| NFJ26_RS11820 | 2503317..2503709 | - | 393 | WP_000200357.1 | invasion regulator SirB2 | - |
| NFJ26_RS11825 | 2503706..2504539 | - | 834 | WP_000456440.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| NFJ26_RS11830 | 2504539..2505621 | - | 1083 | WP_000804714.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T248602 WP_000170963.1 NZ_CP099351:2501327-2501434 [Escherichia marmotae]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT248602 NZ_CP099351:c2501277-2501211 [Escherichia marmotae]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|