Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3267531..3268150 | Replicon | chromosome |
| Accession | NZ_CP099331 | ||
| Organism | Escherichia fergusonii strain RHB44-C03 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NFK96_RS15720 | Protein ID | WP_001280991.1 |
| Coordinates | 3267932..3268150 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NFK96_RS15715 | Protein ID | WP_104917851.1 |
| Coordinates | 3267531..3267905 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK96_RS15705 (3262663) | 3262663..3263856 | + | 1194 | WP_002431407.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFK96_RS15710 (3263879) | 3263879..3267028 | + | 3150 | WP_223684912.1 | efflux RND transporter permease AcrB | - |
| NFK96_RS15715 (3267531) | 3267531..3267905 | + | 375 | WP_104917851.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK96_RS15720 (3267932) | 3267932..3268150 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NFK96_RS15725 (3268647) | 3268647..3269117 | + | 471 | WP_002431406.1 | YlaC family protein | - |
| NFK96_RS15730 (3269256) | 3269256..3270806 | + | 1551 | WP_001260376.1 | EAL domain-containing protein | - |
| NFK96_RS15735 (3270848) | 3270848..3271201 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NFK96_RS15745 (3271580) | 3271580..3271891 | + | 312 | WP_000409907.1 | MGMT family protein | - |
| NFK96_RS15750 (3271922) | 3271922..3272494 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248498 WP_001280991.1 NZ_CP099331:3267932-3268150 [Escherichia fergusonii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14511.31 Da Isoelectric Point: 4.8989
>AT248498 WP_104917851.1 NZ_CP099331:3267531-3267905 [Escherichia fergusonii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|