Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 477906..478422 | Replicon | chromosome |
| Accession | NZ_CP099327 | ||
| Organism | Enterobacter ludwigii strain RHB47-SO-C03 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NFL62_RS02305 | Protein ID | WP_148576588.1 |
| Coordinates | 478138..478422 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NFL62_RS02300 | Protein ID | WP_108647582.1 |
| Coordinates | 477906..478148 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL62_RS02285 (NFL62_02290) | 473903..474643 | + | 741 | WP_014168382.1 | KDGP aldolase family protein | - |
| NFL62_RS02290 (NFL62_02295) | 474762..475898 | + | 1137 | WP_279257988.1 | lactonase family protein | - |
| NFL62_RS02295 (NFL62_02300) | 475918..477828 | + | 1911 | WP_014168384.1 | PRD domain-containing protein | - |
| NFL62_RS02300 (NFL62_02305) | 477906..478148 | + | 243 | WP_108647582.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFL62_RS02305 (NFL62_02310) | 478138..478422 | + | 285 | WP_148576588.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFL62_RS02310 (NFL62_02315) | 478426..478890 | - | 465 | WP_047954963.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFL62_RS02315 (NFL62_02320) | 479029..481167 | - | 2139 | WP_047954964.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFL62_RS02320 (NFL62_02325) | 481535..482107 | - | 573 | WP_032679517.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10863.65 Da Isoelectric Point: 10.3193
>T248458 WP_148576588.1 NZ_CP099327:478138-478422 [Enterobacter ludwigii]
MSYELVFDPRAFKEWTRLGDTVKNQFKKKLANVLVNPRVESARLYGLPDCDKIKLRSQGYRLVYQVHDNVVTVCVIAIGK
REKSAVSHDVNKRL
MSYELVFDPRAFKEWTRLGDTVKNQFKKKLANVLVNPRVESARLYGLPDCDKIKLRSQGYRLVYQVHDNVVTVCVIAIGK
REKSAVSHDVNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|