Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1088204..1088824 | Replicon | chromosome |
Accession | NZ_CP099325 | ||
Organism | Enterobacter ludwigii strain RHB47-SO-C01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | G8LPY2 |
Locus tag | NFL61_RS05190 | Protein ID | WP_014168902.1 |
Coordinates | 1088204..1088422 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | W0BRV6 |
Locus tag | NFL61_RS05195 | Protein ID | WP_020885187.1 |
Coordinates | 1088450..1088824 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL61_RS05160 (NFL61_05160) | 1084215..1084475 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
NFL61_RS05165 (NFL61_05165) | 1084478..1084618 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
NFL61_RS05170 (NFL61_05170) | 1084615..1085325 | - | 711 | WP_020885191.1 | GNAT family protein | - |
NFL61_RS05175 (NFL61_05175) | 1085426..1086886 | + | 1461 | WP_272755829.1 | PLP-dependent aminotransferase family protein | - |
NFL61_RS05180 (NFL61_05180) | 1086858..1087325 | - | 468 | WP_020885189.1 | YlaC family protein | - |
NFL61_RS05185 (NFL61_05185) | 1087443..1087994 | - | 552 | WP_020885188.1 | maltose O-acetyltransferase | - |
NFL61_RS05190 (NFL61_05190) | 1088204..1088422 | - | 219 | WP_014168902.1 | HHA domain-containing protein | Toxin |
NFL61_RS05195 (NFL61_05195) | 1088450..1088824 | - | 375 | WP_020885187.1 | Hha toxicity modulator TomB | Antitoxin |
NFL61_RS05200 (NFL61_05200) | 1089336..1092482 | - | 3147 | WP_014168904.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NFL61_RS05205 (NFL61_05205) | 1092505..1093698 | - | 1194 | WP_020885186.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8654.04 Da Isoelectric Point: 8.9107
>T248450 WP_014168902.1 NZ_CP099325:c1088422-1088204 [Enterobacter ludwigii]
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.8886
>AT248450 WP_020885187.1 NZ_CP099325:c1088824-1088450 [Enterobacter ludwigii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839BM33 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5C1BX74 |