Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 829553..830207 | Replicon | chromosome |
Accession | NZ_CP099037 | ||
Organism | Citrobacter freundii strain RHB44-SO-C05 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | NFL15_RS04055 | Protein ID | WP_003026936.1 |
Coordinates | 829800..830207 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | NFL15_RS04050 | Protein ID | WP_003026938.1 |
Coordinates | 829553..829819 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL15_RS04025 (824754) | 824754..826187 | - | 1434 | WP_279279148.1 | 6-phospho-beta-glucosidase BglA | - |
NFL15_RS04030 (826308) | 826308..827036 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFL15_RS04035 (827089) | 827089..827400 | + | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
NFL15_RS04040 (827563) | 827563..828222 | + | 660 | WP_003026947.1 | hemolysin III family protein | - |
NFL15_RS04045 (828316) | 828316..829296 | - | 981 | WP_003838269.1 | tRNA-modifying protein YgfZ | - |
NFL15_RS04050 (829553) | 829553..829819 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
NFL15_RS04055 (829800) | 829800..830207 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
NFL15_RS04060 (830252) | 830252..830773 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
NFL15_RS04065 (830888) | 830888..831784 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
NFL15_RS04070 (831808) | 831808..832521 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFL15_RS04075 (832527) | 832527..834260 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T248174 WP_003026936.1 NZ_CP099037:829800-830207 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |