Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 3007682..3008415 Replicon chromosome
Accession NZ_CP098719
Organism Yersinia ruckeri strain NVI-11267

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag ND445_RS13930 Protein ID WP_096823575.1
Coordinates 3008086..3008415 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag ND445_RS13925 Protein ID WP_096823574.1
Coordinates 3007682..3008047 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND445_RS13880 (ND445_13875) 3002977..3003678 + 702 WP_050297207.1 WYL domain-containing protein -
ND445_RS13885 (ND445_13880) 3003684..3004250 + 567 WP_096823569.1 hypothetical protein -
ND445_RS13890 (ND445_13885) 3004289..3004741 + 453 WP_096823570.1 hypothetical protein -
ND445_RS13895 (ND445_13890) 3004738..3005176 + 439 Protein_2696 IrmA family protein -
ND445_RS13900 (ND445_13895) 3005249..3005515 + 267 Protein_2697 DUF905 family protein -
ND445_RS13905 (ND445_13900) 3005588..3006409 + 822 WP_096823571.1 DUF932 domain-containing protein -
ND445_RS13910 (ND445_13905) 3006440..3006883 + 444 WP_096823572.1 antirestriction protein -
ND445_RS13915 (ND445_13910) 3006896..3007438 + 543 WP_096823573.1 DNA repair protein RadC -
ND445_RS13920 (ND445_13915) 3007435..3007656 + 222 WP_069325310.1 DUF987 domain-containing protein -
ND445_RS13925 (ND445_13920) 3007682..3008047 + 366 WP_096823574.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ND445_RS13930 (ND445_13925) 3008086..3008415 + 330 WP_096823575.1 TA system toxin CbtA family protein Toxin
ND445_RS13935 (ND445_13930) 3008811..3009740 + 930 Protein_2704 integrase arm-type DNA-binding domain-containing protein -
ND445_RS13940 (ND445_13935) 3009959..3010540 + 582 WP_256466057.1 DUF4942 domain-containing protein -
ND445_RS13945 (ND445_13940) 3010649..3010972 + 324 WP_038277221.1 type II toxin-antitoxin system RelE/ParE family toxin -
ND445_RS13950 (ND445_13945) 3010959..3011240 + 282 WP_038277219.1 helix-turn-helix transcriptional regulator -
ND445_RS13955 (ND445_13950) 3011449..3012989 - 1541 Protein_2708 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3007682..3020784 13102
- flank IS/Tn - - 3013193..3013459 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12376.18 Da        Isoelectric Point: 8.0799

>T247892 WP_096823575.1 NZ_CP098719:3008086-3008415 [Yersinia ruckeri]
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13414.09 Da        Isoelectric Point: 5.4157

>AT247892 WP_096823574.1 NZ_CP098719:3007682-3008047 [Yersinia ruckeri]
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References