Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 2875253..2875986 Replicon chromosome
Accession NZ_CP098714
Organism Yersinia ruckeri strain NVI-1176

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag ND442_RS13360 Protein ID WP_096823575.1
Coordinates 2875657..2875986 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag ND442_RS13355 Protein ID WP_096823574.1
Coordinates 2875253..2875618 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND442_RS13310 (ND442_13305) 2870548..2871249 + 702 WP_050297207.1 WYL domain-containing protein -
ND442_RS13315 (ND442_13310) 2871255..2871821 + 567 WP_096823569.1 hypothetical protein -
ND442_RS13320 (ND442_13315) 2871860..2872312 + 453 WP_096823570.1 hypothetical protein -
ND442_RS13325 (ND442_13320) 2872309..2872747 + 439 Protein_2590 IrmA family protein -
ND442_RS13330 (ND442_13325) 2872820..2873086 + 267 Protein_2591 DUF905 family protein -
ND442_RS13335 (ND442_13330) 2873159..2873980 + 822 WP_096823571.1 DUF932 domain-containing protein -
ND442_RS13340 (ND442_13335) 2874011..2874454 + 444 WP_096823572.1 antirestriction protein -
ND442_RS13345 (ND442_13340) 2874467..2875009 + 543 WP_096823573.1 DNA repair protein RadC -
ND442_RS13350 (ND442_13345) 2875006..2875227 + 222 WP_069325310.1 DUF987 domain-containing protein -
ND442_RS13355 (ND442_13350) 2875253..2875618 + 366 WP_096823574.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ND442_RS13360 (ND442_13355) 2875657..2875986 + 330 WP_096823575.1 TA system toxin CbtA family protein Toxin
ND442_RS13365 (ND442_13360) 2876382..2877311 + 930 Protein_2598 integrase arm-type DNA-binding domain-containing protein -
ND442_RS13370 (ND442_13365) 2877557..2878111 + 555 WP_096823577.1 DUF4942 domain-containing protein -
ND442_RS13375 (ND442_13370) 2878220..2878543 + 324 WP_038277221.1 type II toxin-antitoxin system RelE/ParE family toxin -
ND442_RS13380 (ND442_13375) 2878530..2878811 + 282 WP_038277219.1 helix-turn-helix transcriptional regulator -
ND442_RS13385 (ND442_13380) 2879020..2880560 - 1541 Protein_2602 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2875253..2888355 13102
- flank IS/Tn - - 2880764..2881030 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12376.18 Da        Isoelectric Point: 8.0799

>T247870 WP_096823575.1 NZ_CP098714:2875657-2875986 [Yersinia ruckeri]
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13414.09 Da        Isoelectric Point: 5.4157

>AT247870 WP_096823574.1 NZ_CP098714:2875253-2875618 [Yersinia ruckeri]
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References