Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 546245..546927 Replicon chromosome
Accession NZ_CP098694
Organism Yersinia ruckeri strain NVI-8270

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag ND446_RS02415 Protein ID WP_267262916.1
Coordinates 546586..546927 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag ND446_RS02410 Protein ID WP_267262915.1
Coordinates 546245..546565 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND446_RS02370 (ND446_02370) 541797..542630 + 834 WP_267263002.1 DUF932 domain-containing protein -
ND446_RS02375 (ND446_02375) 542832..543536 + 705 WP_267262908.1 WYL domain-containing protein -
ND446_RS02380 (ND446_02380) 543533..544147 + 615 WP_267262909.1 hypothetical protein -
ND446_RS02385 (ND446_02385) 544237..544647 + 411 WP_267262910.1 hypothetical protein -
ND446_RS02390 (ND446_02390) 544725..544961 + 237 WP_267262911.1 DUF905 domain-containing protein -
ND446_RS02395 (ND446_02395) 545047..545505 + 459 WP_267262912.1 antirestriction protein -
ND446_RS02400 (ND446_02400) 545514..545996 + 483 WP_267262913.1 DNA repair protein RadC -
ND446_RS02405 (ND446_02405) 546005..546226 + 222 WP_267262914.1 DUF987 domain-containing protein -
ND446_RS02410 (ND446_02410) 546245..546565 + 321 WP_267262915.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ND446_RS02415 (ND446_02415) 546586..546927 + 342 WP_267262916.1 TA system toxin CbtA family protein Toxin
ND446_RS02420 (ND446_02420) 547340..547852 + 513 WP_267262917.1 hypothetical protein -
ND446_RS02425 (ND446_02425) 548167..548370 + 204 Protein_466 DUF4942 domain-containing protein -
ND446_RS02430 (ND446_02430) 548591..549649 - 1059 WP_267262918.1 tyrosine-type recombinase/integrase -
ND446_RS02435 (ND446_02435) 549639..550601 - 963 WP_267262919.1 hypothetical protein -
ND446_RS02440 (ND446_02440) 550615..551196 - 582 WP_267262920.1 phage repressor protein CI -
ND446_RS02445 (ND446_02445) 551309..551530 + 222 WP_050124248.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - rfaE 529087..610369 81282


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-105)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12903.87 Da        Isoelectric Point: 9.0089

>T247772 WP_267262916.1 NZ_CP098694:546586-546927 [Yersinia ruckeri]
MKTLPATISRATKPCLSPVAVWQMLLTRLLEQHYGLTLNNTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATSLLRRSHNNAVL

Download         Length: 342 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12047.59 Da        Isoelectric Point: 6.9372

>AT247772 WP_267262915.1 NZ_CP098694:546245-546565 [Yersinia ruckeri]
MRSNVTWGLQRDTTPCLGARLVQEGNQRHYLADRASITGKFSDTECRKLDETFPHFISQMESMLTTGEMNPRHAHCVILY
HNGFTCEADTLGSCGYVYIAVYPTQR

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References