Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1661921..1662606 Replicon chromosome
Accession NZ_CP098546
Organism Neisseria gonorrhoeae strain 9126

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDQ67_RS08665 Protein ID WP_003689143.1
Coordinates 1662424..1662606 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDQ67_RS08660 Protein ID WP_003691454.1
Coordinates 1661921..1662322 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ67_RS08620 (NDQ67_08590) 1657339..1657521 - 183 WP_003691535.1 hypothetical protein -
NDQ67_RS08625 (NDQ67_08595) 1657661..1658347 - 687 WP_010357532.1 hypothetical protein -
NDQ67_RS08630 (NDQ67_08600) 1658416..1658577 - 162 WP_003691530.1 hypothetical protein -
NDQ67_RS08635 (NDQ67_08605) 1658574..1658849 - 276 WP_033911205.1 hypothetical protein -
NDQ67_RS08640 (NDQ67_08610) 1659002..1659334 - 333 WP_003695500.1 hypothetical protein -
NDQ67_RS08645 (NDQ67_08615) 1659880..1660641 + 762 WP_012503753.1 hypothetical protein -
NDQ67_RS08650 (NDQ67_08620) 1660730..1661146 - 417 WP_003700378.1 hypothetical protein -
NDQ67_RS08655 (NDQ67_08625) 1661155..1661790 - 636 WP_225602681.1 Panacea domain-containing protein -
NDQ67_RS08660 (NDQ67_08630) 1661921..1662322 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDQ67_RS08665 (NDQ67_08635) 1662424..1662606 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDQ67_RS08670 (NDQ67_08640) 1662776..1663594 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NDQ67_RS08675 (NDQ67_08645) 1663869..1664624 - 756 WP_003693472.1 LexA family transcriptional regulator -
NDQ67_RS08680 (NDQ67_08650) 1664761..1664946 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NDQ67_RS08685 (NDQ67_08655) 1665035..1665190 + 156 WP_003698902.1 hypothetical protein -
NDQ67_RS08690 (NDQ67_08660) 1665167..1665355 - 189 WP_003691445.1 hypothetical protein -
NDQ67_RS08695 (NDQ67_08665) 1665528..1665755 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NDQ67_RS08700 (NDQ67_08670) 1665752..1666264 + 513 WP_033911191.1 helix-turn-helix domain-containing protein -
NDQ67_RS08705 (NDQ67_08675) 1666278..1666796 + 519 WP_025456213.1 hypothetical protein -
NDQ67_RS08710 (NDQ67_08680) 1666811..1667590 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1645594..1680074 34480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247739 WP_003689143.1 NZ_CP098546:c1662606-1662424 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247739 WP_003691454.1 NZ_CP098546:c1662322-1661921 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References