Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1659051..1659736 Replicon chromosome
Accession NZ_CP098466
Organism Neisseria gonorrhoeae strain 10720

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NC852_RS08635 Protein ID WP_003689143.1
Coordinates 1659554..1659736 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NC852_RS08630 Protein ID WP_003691454.1
Coordinates 1659051..1659452 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NC852_RS08585 (NC852_08520) 1654469..1654651 - 183 WP_003691535.1 hypothetical protein -
NC852_RS08590 (NC852_08525) 1654791..1655477 - 687 WP_010357532.1 hypothetical protein -
NC852_RS08595 (NC852_08530) 1655546..1655707 - 162 WP_003691530.1 hypothetical protein -
NC852_RS08600 (NC852_08535) 1655704..1655979 - 276 WP_033911205.1 hypothetical protein -
NC852_RS08605 (NC852_08540) 1656132..1656464 - 333 WP_003695500.1 hypothetical protein -
NC852_RS08610 (NC852_08545) 1656605..1656769 - 165 WP_003700376.1 hypothetical protein -
NC852_RS08615 (NC852_08550) 1657010..1657771 + 762 WP_012503753.1 hypothetical protein -
NC852_RS08620 (NC852_08555) 1657860..1658276 - 417 WP_003700378.1 hypothetical protein -
NC852_RS08625 (NC852_08560) 1658285..1658869 - 585 WP_003693477.1 Panacea domain-containing protein -
NC852_RS08630 (NC852_08565) 1659051..1659452 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NC852_RS08635 (NC852_08570) 1659554..1659736 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NC852_RS08640 (NC852_08575) 1659906..1660724 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NC852_RS08645 (NC852_08580) 1660999..1661754 - 756 WP_003693472.1 LexA family transcriptional regulator -
NC852_RS08650 (NC852_08585) 1661891..1662076 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NC852_RS08655 (NC852_08590) 1662165..1662320 + 156 WP_003698902.1 hypothetical protein -
NC852_RS08660 (NC852_08595) 1662297..1662485 - 189 WP_003691445.1 hypothetical protein -
NC852_RS08665 (NC852_08600) 1662658..1662885 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NC852_RS08670 (NC852_08605) 1662882..1663904 + 1023 WP_258825497.1 helix-turn-helix domain-containing protein -
NC852_RS08675 (NC852_08610) 1663919..1664698 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1645220..1677201 31981


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247672 WP_003689143.1 NZ_CP098466:c1659736-1659554 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247672 WP_003691454.1 NZ_CP098466:c1659452-1659051 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References