Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 951474..952129 | Replicon | chromosome |
| Accession | NZ_CP098466 | ||
| Organism | Neisseria gonorrhoeae strain 10720 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NC852_RS04920 | Protein ID | WP_229931500.1 |
| Coordinates | 951474..951893 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | NC852_RS04925 | Protein ID | WP_003688410.1 |
| Coordinates | 951893..952129 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC852_RS04900 (NC852_04865) | 946708..948249 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
| NC852_RS04905 (NC852_04870) | 948397..949176 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| NC852_RS04910 (NC852_04875) | 949173..949874 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| NC852_RS04915 (NC852_04880) | 949871..951325 | + | 1455 | WP_263584105.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| NC852_RS04920 (NC852_04885) | 951474..951893 | - | 420 | WP_229931500.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| NC852_RS04925 (NC852_04890) | 951893..952129 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| NC852_RS04930 (NC852_04895) | 952576..953154 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
| NC852_RS04935 (NC852_04900) | 953159..953560 | - | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
| NC852_RS04940 (NC852_04905) | 953799..954185 | + | 387 | Protein_970 | transposase | - |
| NC852_RS04945 (NC852_04910) | 954568..955458 | - | 891 | WP_229931474.1 | succinate--CoA ligase subunit alpha | - |
| NC852_RS04950 (NC852_04915) | 955469..956635 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| NC852_RS04955 (NC852_04920) | 956707..956994 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15336.67 Da Isoelectric Point: 5.5742
>T247671 WP_229931500.1 NZ_CP098466:c951893-951474 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|