Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 705479..706011 Replicon chromosome
Accession NZ_CP098455
Organism Spongiibacter taiwanensis strain SPT1

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NCG89_RS03435 Protein ID WP_251088376.1
Coordinates 705718..706011 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag NCG89_RS03430 Protein ID WP_251088375.1
Coordinates 705479..705718 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NCG89_RS03400 (NCG89_03400) 700999..701610 + 612 WP_251088369.1 methyltransferase domain-containing protein -
NCG89_RS03405 (NCG89_03405) 701735..702262 + 528 WP_251088370.1 phosphatase PAP2 family protein -
NCG89_RS03410 (NCG89_03410) 702291..703349 + 1059 WP_251088371.1 glycosyltransferase family protein -
NCG89_RS03415 (NCG89_03415) 703356..704450 + 1095 WP_251088372.1 DUF2817 domain-containing protein -
NCG89_RS03420 (NCG89_03420) 704460..705233 + 774 WP_251088373.1 alpha/beta hydrolase -
NCG89_RS03425 (NCG89_03425) 705230..705328 - 99 WP_251088374.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NCG89_RS03430 (NCG89_03430) 705479..705718 + 240 WP_251088375.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
NCG89_RS03435 (NCG89_03435) 705718..706011 + 294 WP_251088376.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NCG89_RS03440 (NCG89_03440) 706345..706590 + 246 WP_251088377.1 type II toxin-antitoxin system CcdA family antitoxin -
NCG89_RS03445 (NCG89_03445) 706590..706907 + 318 WP_251088378.1 CcdB family protein -
NCG89_RS03450 (NCG89_03450) 707024..707314 - 291 WP_251088379.1 HigA family addiction module antitoxin -
NCG89_RS03460 (NCG89_03460) 707446..707589 - 144 WP_251089398.1 hypothetical protein -
NCG89_RS03465 (NCG89_03465) 707720..708310 - 591 WP_251088381.1 hypothetical protein -
NCG89_RS03470 (NCG89_03470) 708472..708690 - 219 WP_251088382.1 hypothetical protein -
NCG89_RS03475 (NCG89_03475) 709275..710921 - 1647 WP_251088383.1 glycoside hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-92)

Antitoxin

Antitoxin ParD

(4-71)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11225.94 Da        Isoelectric Point: 10.2910

>T247661 WP_251088376.1 NZ_CP098455:705718-706011 [Spongiibacter taiwanensis]
MPPFLLTSAARKDIIDIGRFTSEKWGKRQRDKYLKQLDDAFRLLARQPEIGHAAEDIKPGYKKFSQGSHIIFYRSGTESK
IVVVRILHNSMDVDQHL

Download         Length: 294 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8789.71 Da        Isoelectric Point: 4.2925

>AT247661 WP_251088375.1 NZ_CP098455:705479-705718 [Spongiibacter taiwanensis]
MARNTSITLGPHFDEFIAAQLENGRYGSASEVVRAGLRLLEETESKLERLRRLLDEGEQSGIAEYSLDSVIAELDNEAH

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References