Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 9840..10109 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP098439 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M9193_RS23145 | Protein ID | WP_001372321.1 |
| Coordinates | 9984..10109 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 9840..9905 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9193_RS23110 | 5296..5502 | + | 207 | WP_000547975.1 | hypothetical protein | - |
| M9193_RS23115 | 5528..6067 | + | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
| M9193_RS23120 | 6130..6363 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| M9193_RS23125 | 6429..8452 | + | 2024 | Protein_11 | ParB/RepB/Spo0J family partition protein | - |
| M9193_RS23130 | 8521..8955 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M9193_RS23135 | 8952..9671 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 9683..9907 | + | 225 | NuclAT_0 | - | - |
| - | 9683..9907 | + | 225 | NuclAT_0 | - | - |
| - | 9683..9907 | + | 225 | NuclAT_0 | - | - |
| - | 9683..9907 | + | 225 | NuclAT_0 | - | - |
| - | 9840..9905 | - | 66 | - | - | Antitoxin |
| M9193_RS23140 | 9893..10042 | + | 150 | Protein_14 | plasmid maintenance protein Mok | - |
| M9193_RS23145 | 9984..10109 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M9193_RS23150 | 10428..10724 | - | 297 | Protein_16 | hypothetical protein | - |
| M9193_RS23155 | 11024..11320 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| M9193_RS23160 | 11431..12252 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| M9193_RS23165 | 12549..13139 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| M9193_RS23170 | 13474..13857 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M9193_RS23175 | 14051..14722 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| M9193_RS23180 | 14859..15086 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..109442 | 109442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T247636 WP_001372321.1 NZ_CP098439:9984-10109 [Salmonella enterica subsp. enterica serovar Typhimurium]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT247636 NZ_CP098439:c9905-9840 [Salmonella enterica subsp. enterica serovar Typhimurium]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|