Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4985850..4986366 | Replicon | chromosome |
| Accession | NZ_CP098343 | ||
| Organism | Klebsiella pneumoniae strain 53009_G1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | NB668_RS24595 | Protein ID | WP_002886902.1 |
| Coordinates | 4985850..4986134 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NB668_RS24600 | Protein ID | WP_002886901.1 |
| Coordinates | 4986124..4986366 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB668_RS24570 (NB668_24565) | 4981334..4981597 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| NB668_RS24575 (NB668_24570) | 4981727..4981900 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| NB668_RS24580 (NB668_24575) | 4981903..4982646 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NB668_RS24585 (NB668_24580) | 4983003..4985141 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NB668_RS24590 (NB668_24585) | 4985382..4985846 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NB668_RS24595 (NB668_24590) | 4985850..4986134 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NB668_RS24600 (NB668_24595) | 4986124..4986366 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NB668_RS24605 (NB668_24600) | 4986444..4988354 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NB668_RS24610 (NB668_24605) | 4988377..4989531 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NB668_RS24615 (NB668_24610) | 4989597..4990337 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T247492 WP_002886902.1 NZ_CP098343:c4986134-4985850 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |